EIF3K Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9969
Zusätzliche Namen:: ARG134|EIF3-p28|EIF3K|EIF3S12|HSPC029|M9|MSTP001|PLAC-24|PLAC24|PRO1474|PTD001
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MAMFEQMRANVGKLLKGIDRYNPENLATLERYVETQAKENAYDLEANLAVLKLYQFNPAFFQTTVTAQILLKALTNLPHTDFTLCKCMIDQAHQEERPIRQILYLGDLLETCHFQAFWQALDENMDLLEGITGFEDSVRKFICHVVGITYQHIDRWLLAEMLGDLSDSQLKVWMSKYGWSADESGQIFICSQEESIKPKNIVEKIDFDSVSSIMASSQ
Uniprot:: Q9UBQ5
Synonyme:: ARG134;eIF-3 p25;eIF-3 p28;EIF3-p28;EIF3S12;Eukaryotic translation initiation factor 3 subunit 12;eukaryotic translation initiation factor 3 subunit K;eukaryotic translation initiation factor 3, subunit 12;HSPC029;M9;MSTP001;muscle specific;muscle-specific gene M9 protein;PLAC-24;PLAC24;PRO1474;PTD001
Weitere Details:: The 700-kD eukaryotic translation initiation factor-3 (eIF3) is the largest eIF and contains at least 12 subunits, including EIF2S12. eIF3 plays an essential role in translation by binding directly to the 40S ribosomal subunit and promoting formation of the 40S preinitiation complex (Mayeur et al., 2003 [PubMed 14519125]).