A9950
BAF60a Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A9950
- Zusätzliche Namen:
- Baf60a|D15Kz1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 58kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAARAGFQSVAPSGGAGASGGAGVAAALGPGGTPGPPVRMGPAPGQGLYRSPMPGAAYPRPGMLPGSRMTPQGPSMGPPGYGGNPSVRPGLAQSGMDQSRKRPAPQQIQQVQQQAVQNRN
- Uniprot:
- Q96GM5
- Synonyme:
- 60 kDa BRG-1/Brm-associated factor subunit A;AA407987;Baf6;BAF60A;BRG1-associated factor 60A;chromatin remodeling complex BAF60A subunit;CRACD1;CSS11;D15Kz1;mammalian chromatin remodeling complex BRG1-associated factor 60A;Rsc6p;SWI/SNF complex 60 kDa subunit;SWI/SNF complex 60 kDa subunit A;SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily D member 1;Swp73-like protein
- Weitere Details:
- Predicted to enable several functions, including chromatin binding activity; molecular adaptor activity; and transcription coregulator activity. Predicted to be involved in epigenetic maintenance of chromatin in transcription-competent conformation; nucleosome disassembly; and regulation of transcription by RNA polymerase II. Predicted to act upstream of or within chromatin organization and nervous system development. Part of SWI/SNF complex; nBAF complex; and npBAF complex. Is expressed in several structures, including central nervous system; dorsal root ganglion; early conceptus; genitourinary system; and retina layer. Human ortholog(s) of this gene implicated in Coffin-Siris syndrome. Orthologous to human SMARCD1 (SWI/SNF related, matrix associated, actin dependent regulator of chromatin, subfamily d, member 1).
- Versandbedingungen:
- Blue Ice







