MT-ND4 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9941
Zusätzliche Namen:: MT-ND4|ND4
Anwendung:: ELISA, WB
Molekulargewicht:: 51 kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LMASLANLALPPSINLMGELFITMSLFSWSNFTIILMGINIIITGMYSMYMIITTQRGKLTNHMINLQPSHTRELTLMALHMIPLILLTTSPKLITGLTM
Synonyme:: MTND4;NADH dehydrogenase subunit 4
Weitere Details:: Predicted to enable NADH dehydrogenase (ubiquinone) activity and ubiquinone binding activity. Predicted to contribute to NADH dehydrogenase activity. Predicted to be involved in several processes, including electron transport coupled proton transport; mitochondrial electron transport, NADH to ubiquinone; and mitochondrial respiratory chain complex I assembly. Located in mitochondrion. Human ortholog(s) of this gene implicated in Leber hereditary optic neuropathy; Parkinson's disease; macular degeneration; and schizophrenia. Orthologous to human MT-ND4 (mitochondrially encoded NADH:ubiquinone oxidoreductase core subunit 4).