A9939
MT-CO3 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9939
- Zusätzliche Namen:
- COX3|MT-CO3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 30kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MTHQTHAYHMVNPSPWPLTGAFSALLLTSGLVMWFHYNSITLLTLGLLTNILTMYQWWRDVIREGTYQGHHTPIVQKGLRYGMILFIVSEVFFFAGFFWA
- Synonyme:
- COIII;cytochrome c oxidase subunit III;MTCO3
- Weitere Details:
- Predicted to enable electron transfer activity and oxidoreduction-driven active transmembrane transporter activity. Predicted to be involved in mitochondrial electron transport, cytochrome c to oxygen and respiratory chain complex IV assembly. Located in mitochondrion. Is expressed in several structures, including alimentary system; brain; heart; integumental system; and sensory organ. Human ortholog(s) of this gene implicated in MELAS syndrome. Orthologous to human MT-CO3 (mitochondrially encoded cytochrome c oxidase III).
- Versandbedingungen:
- Blue Ice