ITGAE Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9934
Zusätzliche Namen:: CD103|HUMINAE|ITGAE
Anwendung:: ELISA, WB
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: FNVDVARPWLTPKGGAPFVLSSLLHQDPSTNQTWLLVTSPRTKRTPGPLHRCSLVQDEILCHPVEHVPIPKGRHRGVTVVRSHHGVLICIQVLVRRPHSLSSELTGTCSLLGPDLRPQAQANFFDLENLLDPDARVDTGDCYSNKEGGGEDDVNTARQRRALEKEEEEDKEEEEDEEEEEAG
Uniprot:: P38570
Synonyme:: antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide;CD103;HML-1 antigen;human mucosal lymphocyte antigen 1, alpha polypeptide;HUMINAE;integrin alpha-E;integrin alpha-IEL;integrin, alpha E (antigen CD103, human mucosal lymphocyte antigen 1; alpha polypeptide);mucosal lymphocyte 1 antigen
Weitere Details:: Integrins are heterodimeric integral membrane proteins composed of an alpha chain and a beta chain. This gene encodes an I-domain-containing alpha integrin that undergoes post-translational cleavage in the extracellular domain, yielding disulfide-linked heavy and light chains. In combination with the beta 7 integrin, this protein forms the E-cadherin binding integrin known as the human mucosal lymphocyte-1 antigen. This protein is preferentially expressed in human intestinal intraepithelial lymphocytes (IEL), and in addition to a role in adhesion, it may serve as an accessory molecule for IEL activation.

Versandbedingungen:: Blue Ice