A9928
ATP1B2 Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A9928
- Zusätzliche Namen:
- AMOG|ATP1B2
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 42kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DHTPKYQDRLATPGLMIRPKTENLDVIVNVSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGANQSMNVTCAGKRDEDAENLGNFVMFPANGNIDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATDDERDKFAGRVAFKLRINKT
- Uniprot:
- P14415
- Synonyme:
- adhesion molecule in glia;adhesion molecule on glia;AMOG;ATPase, Na+/K+ transporting, beta 2 polypeptide;Na, K-ATPase beta-2 polypeptide;sodium pump subunit beta-2;sodium-potassium ATPase subunit beta 2 (non-catalytic);sodium/potassium-dependent ATPase beta-2 subunit;sodium/potassium-dependent ATPase subunit beta-2;sodium/potassium-transporting ATPase beta-2 chain;sodium/potassium-transporting ATPase subunit beta-2
- Weitere Details:
- The protein encoded by this gene belongs to the family of Na+/K+ and H+/K+ ATPases beta chain proteins, and to the subfamily of Na+/K+ -ATPases. Na+/K+ -ATPase is an integral membrane protein responsible for establishing and maintaining the electrochemical gradients of Na and K ions across the plasma membrane. These gradients are essential for osmoregulation, for sodium-coupled transport of a variety of organic and inorganic molecules, and for electrical excitability of nerve and muscle. This enzyme is composed of two subunits, a large catalytic subunit (alpha) and a smaller glycoprotein subunit (beta). The beta subunit regulates, through assembly of alpha/beta heterodimers, the number of sodium pumps transported to the plasma membrane. The glycoprotein subunit of Na+/K+ -ATPase is encoded by multiple genes. This gene encodes a beta 2 subunit. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice



