A9892
STRA13 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9892
- Zusätzliche Namen:
- CENP-X|D9|FAAP10|MHF2|STRA13
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEGAGAGSGFRKELVSRLLHLHFKDDKTKEAAVRGVRQAQAEDALRVDVDQLEKVLPQLLLDF
- Uniprot:
- A8MT69
- Synonyme:
- CENP-X;centromere protein X;D9;FAAP10;FANCM associated histone fold protein 2;FANCM-associated histone fold protein 2;FANCM-interacting histone fold protein 2;Fanconi anemia-associated polypeptide of 10 kDa;MHF2;retinoic acid-inducible gene D9 protein homolog;stimulated by retinoic acid 13 homolog;stimulated by retinoic acid gene 13 protein homolog;STRA13
- Weitere Details:
- Enables DNA binding activity. Contributes to double-stranded DNA binding activity. Involved in replication fork processing and resolution of meiotic recombination intermediates. Part of FANCM-MHF complex and Fanconi anaemia nuclear complex.
- Versandbedingungen:
- Blue Ice