NLRP5 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9886
Zusätzliche Namen:: CLR19.8|MATER|NALP5|NLRP5|PAN11|PYPAF8
Anwendung:: ELISA, WB
Molekulargewicht:: 134kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TMTDQGPSKEKVPGISQAVQQDSATAAETKEQEISQAMEQEGATAAETEEQEISQAMEQEGATAAETEEQGHGGDTWDYKSHVMTKFAEEEDVRRSFENT
Uniprot:: P59047
Synonyme:: CLR19.8;MATER;mater protein homolog;maternal antigen that embryos require;NACHT, leucine rich repeat and PYD containing 5;NACHT, LRR and PYD domains-containing protein 5;NALP5;nucleotide-binding oligomerization domain, leucine rich repeat and pyrin domain containing 5;PAN11;PYPAF8
Weitere Details:: The protein encoded by this gene belongs to the NALP protein family. Members of the NALP protein family typically contain a NACHT domain, a NACHT-associated domain (NAD), a C-terminal leucine-rich repeat (LRR) region, and an N-terminal pyrin domain (PYD). Expression of this gene is restricted to the oocyte. A mouse gene that encodes a maternal oocyte protein, similar to this encoded protein, is required for normal early embryogenesis.