A9882
POLE4 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9882
- Zusätzliche Namen:
- p12|POLE4|YHHQ1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 17 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAAAAAAGSGTPREEEGPAGEAAASQPQAPTSVPGARLSRLPLARVKALVKADPDVTLAGQEAIFILARAAELFVETIAKDAYCCAQQGKRKTLQRRDLDNAIEAVDEFAFLEGTLD
- Uniprot:
- Q9NR33
- Synonyme:
- DNA polymerase epsilon subunit 4;DNA polymerase epsilon subunit p12;DNA polymerase II subunit 4;p12;polymerase (DNA-directed), epsilon 4, accessory subunit;polymerase (DNA) epsilon 4, accessory subunit;YHHQ1
- Weitere Details:
- POLE4 is a histone-fold protein that interacts with other histone-fold proteins to bind DNA in a sequence-independent manner. These histone-fold protein dimers combine within larger enzymatic complexes for DNA transcription, replication, and packaging.
- Versandbedingungen:
- Blue Ice