A9872
UQCRQ Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9872
- Zusätzliche Namen:
- MC3DN4|QCR8|QP-C|QPC|UQCR7|UQCRQ
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGREFGNLTRMRHVISYSLSPFEQRAYPHVFTKGIPNVLRRIRESFFRVVPQFVVFYLIYTWGTEEFERSKRKNPAAYENDK
- Uniprot:
- O14949
- Synonyme:
- complex III subunit 8;complex III subunit VIII;cytochrome b-c1 complex subunit 8;low molecular mass ubiquinone-binding protein (9.5kD);MC3DN4;QCR8;QP-C;QPC;ubiquinol-cytochrome c reductase complex 9.5 kDa protein;ubiquinol-cytochrome c reductase complex ubiquinone-binding protein QP-C;ubiquinol-cytochrome c reductase, complex III subunit VII, 9.5kDa;UQCR7
- Weitere Details:
- This gene encodes a ubiquinone-binding protein of low molecular mass. This protein is a small core-associated protein and a subunit of ubiquinol-cytochrome c reductase complex III, which is part of the mitochondrial respiratory chain.
- Versandbedingungen:
- Blue Ice