KCNE2 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9859
Zusätzliche Namen:: ATFB4|KCNE2|LQT5|LQT6|MIRP1
Anwendung:: ELISA, WB
Molekulargewicht:: 15kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSTLSNFTQTLEDVFRRIFITYMDNWRQNTTAEQEALQAKVDAENFYYVILYLMVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQI
Uniprot:: Q9Y6J6
Synonyme:: ATFB4;cardiac voltage-gated potassium channel accessory subunit 2;LQT5;LQT6;minimum potassium ion channel-related peptide 1;MinK-related peptide 1;minK-related peptide-1;MIRP1;potassium channel subunit beta MiRP1;potassium channel subunit, MiRP1;potassium channel, voltage gated subfamily E regulatory beta subunit 2;potassium voltage-gated channel subfamily E member 2;potassium voltage-gated channel, Isk-related family, member 2;voltage-gated K+ channel subunit MIRP1
Weitere Details:: Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia.

Versandbedingungen:: Blue Ice