S100A9 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A9842
Zusätzliche Namen:: 60B8AG|CAGB|CFAG|CGLB|L1AG|LIAG|MAC387|MIF|MRP14|NIF|P14|S100-A9|S100A9
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 14 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: HQYSVKLGHPDTLNQGEFKELVRKDLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEKMHEGDEGPGHHHKPGLGEGTP
Uniprot:: P06702
Synonyme:: 60B8AG;CAGB;calgranulin B;Calgranulin-B;calprotectin L1H subunit;CFAG;CGLB;L1AG;leukocyte L1 complex heavy chain;LIAG;MAC387;MIF;migration inhibitory factor-related protein 14;MRP-14;MRP14;NIF;P14;protein S100-A9;S100 calcium-binding protein A9;S100-A9
Weitere Details:: The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21. This protein may function in the inhibition of casein kinase and altered expression of this protein is associated with the disease cystic fibrosis. This antimicrobial protein exhibits antifungal and antibacterial activity.

Versandbedingungen:: Blue Ice