A9832
NFYC Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9832
- Zusätzliche Namen:
- CBF-C|CBFC|H1TF2A|HAP5|HSM|NF-YC|NFYC
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 50kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEEIRNLTVKDFRVQELPLARIKKIMKLDEDVKMISAEAPVLFAKAAQIFITELTLRAWIHTEDNKRRTLQRNDIAMAITKFDQFDFLIDIVPR
- Uniprot:
- Q13952
- Synonyme:
- CAAT box DNA-binding protein subunit C;CBF-C;CBFC;CCAAT binding factor subunit C;CCAAT transcription binding factor subunit gamma;H1TF2A;HAP5;histone H1 transcription factor large subunit 2A;HSM;NF-YC;nuclear transcription factor Y subunit C;nuclear transcription factor Y subunit gamma;nuclear transcription factor Y, gamma;transactivator HSM-1;transactivator HSM-1/2;transcription factor NF-Y, C subunit
- Weitere Details:
- This gene encodes one subunit of a trimeric complex forming a highly conserved transcription factor that binds with high specificity to CCAAT motifs in the promoters of a variety of genes. The encoded protein, subunit C, forms a tight dimer with the B subunit, a prerequisite for subunit A association. The resulting trimer binds to DNA with high specificity and affinity. Subunits B and C each contain a histone-like motif. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice