A9831
NDUFA6 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9831
- Zusätzliche Namen:
- B14|CI-B14|LYRM6|MC1DN33|NADHB14|NDUFA6
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 13kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ATSTASTFVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHQFQLDITVKMGRDKVREMFMKNAHVTDPRVVDLLVIKGKIELEETIKVWKQRTHVMRFFHETEAPRPKDFLSKFYVGHDP
- Uniprot:
- P56556
- Synonyme:
- B14;CI-B14;Complex I-B14;LYR motif-containing protein 6;LYRM6;MC1DN33;NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6;NADH-ubiquinone oxidoreductase 1 alpha subcomplex, 6;NADH-ubiquinone oxidoreductase B14 subunit;NADHB14
- Weitere Details:
- This gene encodes a member of the LYR family of proteins that contain a highly conserved tripeptide (LYR) motif near the N-terminus. The encoded protein is an accessory subunit of NADH: ubiquinone oxidorerductase (Complex I), which is the largest enzyme of the mitochondrial membrane respiratory chain. Complex I functions in electron transfer from NADH to the respiratory chain.
- Versandbedingungen:
- Blue Ice