MYO5A Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9830
Zusätzliche Namen:: GS1|MYH12|MYO5|MYO5A|MYR12
Anwendung:: ELISA, WB
Molekulargewicht:: 240kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADRYKQETEQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDLKEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKKVPL
Uniprot:: Q9Y4I1
Synonyme:: dilute myosin heavy chain, non-muscle;GS1;MYH12;MYO5;Myosin heavy chain 12;myosin V;myosin VA (heavy chain 12, myoxin);myosin-12;myosin-Va;myosin, heavy polypeptide kinase;myoxin;MYR12;unconventional myosin-Va
Weitere Details:: This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined.

Versandbedingungen:: Blue Ice