A9830
MYO5A Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A9830
- Zusätzliche Namen:
- GS1|MYH12|MYO5|MYO5A|MYR12
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 240kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LTNLEGIYNSETEKLRSDLERLQLSEEEAKVATGRVLSLQEEIAKLRKDLEQTRSEKKCIEEHADRYKQETEQLVSNLKEENTLLKQEKEALNHRIVQQAKEMTETMEKKLVEETKQLELDLNDERLRYQNLLNEFSRLEERYDDLKEEMTLMVHVPKPGHKRTDSTHSSNESEYIFSSEIAEMEDIPSRTEEPSEKKVPL
- Uniprot:
- Q9Y4I1
- Synonyme:
- dilute myosin heavy chain, non-muscle;GS1;MYH12;MYO5;Myosin heavy chain 12;myosin V;myosin VA (heavy chain 12, myoxin);myosin-12;myosin-Va;myosin, heavy polypeptide kinase;myoxin;MYR12;unconventional myosin-Va
- Weitere Details:
- This gene is one of three myosin V heavy-chain genes, belonging to the myosin gene superfamily. Myosin V is a class of actin-based motor proteins involved in cytoplasmic vesicle transport and anchorage, spindle-pole alignment and mRNA translocation. The protein encoded by this gene is abundant in melanocytes and nerve cells. Mutations in this gene cause Griscelli syndrome type-1 (GS1), Griscelli syndrome type-3 (GS3) and neuroectodermal melanolysosomal disease, or Elejalde disease. Multiple alternatively spliced transcript variants encoding different isoforms have been reported, but the full-length nature of some variants has not been determined.
- Versandbedingungen:
- Blue Ice

