A9824
KCNJ3 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9824
- Zusätzliche Namen:
- GIRK1|KCNJ3|KGA|KIR3.1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 56kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NGRCNVQHGNLGSETSRYLSDLFTTLVDLKWRWNLFIFILTYTVAWLFMASMWWVIAYTRGDLNKAHVGNYTPCVANVYNFPSAFLFFIETEATIGYGYRY
- Uniprot:
- P48549
- Synonyme:
- G protein-activated inward rectifier potassium channel 1;GIRK-1;GIRK1;inward rectifier K(+) channel Kir3.1;inward rectifier K+ channel KIR3.1;KGA;KIR3.1;potassium channel, inwardly rectifying subfamily J member 3;potassium inwardly-rectifying channel subfamily J member 3 splice variant 1e;potassium voltage-gated channel subfamily J member 3
- Weitere Details:
- Potassium channels are present in most mammalian cells, where they participate in a wide range of physiologic responses. The protein encoded by this gene is an integral membrane protein and inward-rectifier type potassium channel. The encoded protein, which has a greater tendency to allow potassium to flow into a cell rather than out of a cell, is controlled by G-proteins and plays an important role in regulating heartbeat. It associates with three other G-protein-activated potassium channels to form a heteromultimeric pore-forming complex that also couples to neurotransmitter receptors in the brain and whereby channel activation can inhibit action potential firing by hyperpolarizing the plasma membrane. These multimeric G-protein-gated inwardly-rectifying potassium (GIRK) channels may play a role in the pathophysiology of epilepsy, addiction, Down's syndrome, ataxia, and Parkinson's disease. Alternative splicing results in multiple transcript variants encoding distinct proteins.
- Versandbedingungen:
- Blue Ice