A9817
GNG3 Rabbit polyclonal antibody
Größe
£151.00
- SKU:
- A9817
- Zusätzliche Namen:
- GNG3|HG3D
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 14kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL
- Uniprot:
- P63215
- Synonyme:
- guanine nucleotide binding protein (G protein), gamma 3;guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3;guanine nucleotide-binding protein gamma-3 subunit;NBP gamma-3
- Weitere Details:
- Guanine nucleotide binding proteins are heterotrimeric signal-transducing molecules consisting of alpha, beta, and gamma subunits. The gamma subunit determines the specificity of which signaling pathways will be affected by this particular complex. The protein encoded by this gene represents the gamma subunit of both inhibitory and stimulatory complexes.
- Versandbedingungen:
- Blue Ice