A9811
TIMM8A Rabbit polyclonal antibody

Größe
£151.00
- SKU:
- A9811
- Zusätzliche Namen:
- DDP|DDP1|DFN1|MTS|TIM8|TIMM8A
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 11kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MDSSSSSSAAGLGAVDPQLQHFIEVETQKQRFQQLVHQMTELCWEKCMDKPGPKLDSRAEACFVNCVERFIDTSQFILNRLEQTQKSKPVFSESLSD
- Uniprot:
- O60220
- Synonyme:
- DDP;DDP1;deafness dystonia protein 1;deafness/dystonia peptide;DFN1;mitochondrial import inner membrane translocase subunit Tim8 A;MTS;TIM8;translocase of inner mitochondrial membrane 8 homolog A;X-linked deafness dystonia protein
- Weitere Details:
- This translocase is involved in the import and insertion of hydrophobic membrane proteins from the cytoplasm into the mitochondrial inner membrane. The gene is mutated in Mohr-Tranebjaerg syndrome/Deafness Dystonia Syndrome (MTS/DDS) and it is postulated that MTS/DDS is a mitochondrial disease caused by a defective mitochondrial protein import system. Defects in this gene also cause Jensen syndrome; an X-linked disease with opticoacoustic nerve atrophy and muscle weakness. This protein, along with TIMM13, forms a 70 kDa heterohexamer. Alternative splicing results in multiple transcript variants encoding distinct isoforms.
- Versandbedingungen:
- Blue Ice



