A9772
CDC34 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A9772
- Zusätzliche Namen:
- CDC34|E2-CDC34|UBC3|UBCH3|UBE2R1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 32 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LQEEPVEGFRVTLVDEGDLYNWEVAIFGPPNTYYEGGYFKARLKFPIDYPYSPPAFRFLTKMWHPNIYETGDVCISILHPPVDDPQSGELPSERWNPTQNVRTILLSVISLLNEPNTFSPANVDASVMYRKWKESKGKDREYTDIIRKQVLGTKVDAERDGVKVPTTLAEYCVKTKAPAPDEGSDLFYDDYYEDGEVEEEADSCFGDDEDDSGTEES
- Uniprot:
- P49427
- Synonyme:
- (E3-independent) E2 ubiquitin-conjugating enzyme R1;cell division cycle 34 homolog;E2 ubiquitin-conjugating enzyme R1;E2-CDC34;UBC3;UBCH3;UBE2R1;ubiquitin carrier protein;ubiquitin-conjugating enzyme E2 R1;ubiquitin-conjugating enzyme E2-32 KDA complementing;ubiquitin-conjugating enzyme E2-CDC34;ubiquitin-protein ligase R1
- Weitere Details:
- The protein encoded by this gene is a member of the ubiquitin-conjugating enzyme family. Ubiquitin-conjugating enzyme catalyzes the covalent attachment of ubiquitin to other proteins. This protein is a part of the large multiprotein complex, which is required for ubiquitin-mediated degradation of cell cycle G1 regulators, and for the initiation of DNA replication.
- Versandbedingungen:
- Blue Ice

