A9770
CD3D Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9770
- Zusätzliche Namen:
- CD3-DELTA|CD3D|CD3DELTA|IMD19|T3D
- Anwendung:
- ELISA, Flow Cytometry, WB, IF
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- RCNGTDIYKDKESTVQVHYRMCQSCVELDPATVAGIIVTDVIATLLLALGVFCFAGHETGRLSGAADTQALLRNDQVYQPLRDRDDAQYSHLGGNWARNK
- Uniprot:
- P04234
- Synonyme:
- CD3 antigen, delta subunit;CD3 delta;CD3-DELTA;CD3d antigen, delta polypeptide (TiT3 complex);CD3d molecule, delta (CD3-TCR complex);IMD19;OKT3, delta chain;T-cell receptor T3 delta chain;T-cell surface glycoprotein CD3 delta chain;T3D
- Weitere Details:
- The protein encoded by this gene is part of the T-cell receptor/CD3 complex (TCR/CD3 complex) and is involved in T-cell development and signal transduction. The encoded membrane protein represents the delta subunit of the CD3 complex, and along with four other CD3 subunits, binds either TCR alpha/beta or TCR gamma/delta to form the TCR/CD3 complex on the surface of T-cells. Defects in this gene are a cause of severe combined immunodeficiency autosomal recessive T-cell-negative/B-cell-positive/NK-cell-positive (SCIDBNK). Two transcript variants encoding different isoforms have been found for this gene. Other variants may also exist, but the full-length natures of their transcripts has yet to be defined.
- Versandbedingungen:
- Blue Ice