HES5 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9768
Zusätzliche Namen:: bHLHb38|HES5
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SPKEKNRLRKPVVEKMRRDRINSSIEQLKLLLEQEFARHQPNSKLEKADILEMAVSYLKHSKAFVAAAGPKSLHQDYSEGYSWCLQEAVQFLTLHAASDTQMKLLYHFQRPPAAPAAPAKEPKAPGAAPPP
Uniprot:: Q5TA89
Synonyme:: bHLHb38;class B basic helix-loop-helix protein 38;hairy and enhancer of split 5;transcription factor HES-5
Weitere Details:: This gene encodes a member of a family of basic helix-loop-helix transcriptional repressors. The protein product of this gene, which is activated downstream of the Notch pathway, regulates cell differentiation in multiple tissues. Disruptions in the normal expression of this gene have been associated with developmental diseases and cancer.