A9752
Alpha-2-Macroglobulin (A2M) Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A9752
- Zusätzliche Namen:
- A2MD|Alpha-2-Macroglobulin (A2M)|CPAMD5|FWP007|S863-7
- Anwendung:
- ELISA, WB, IHC-P, IF
- Molekulargewicht:
- 185kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- QAPSAEVEMTSYVLLAYLTAQPAPTSEDLTSATNIVKWITKQQNAQGGFSSTQDTVVALHALSKYGAATFTRTGKAAQVTIQSSGTFSSKFQVDNNNRLLL
- Uniprot:
- P01023
- Synonyme:
- A2MD;alpha-2-M;alpha-2-macroglobulin;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 5;CPAMD5;FWP007;S863-7
- Weitere Details:
- The protein encoded by this gene is a protease inhibitor and cytokine transporter. It uses a bait-and-trap mechanism to inhibit a broad spectrum of proteases, including trypsin, thrombin and collagenase. It can also inhibit inflammatory cytokines, and it thus disrupts inflammatory cascades. Mutations in this gene are a cause of alpha-2-macroglobulin deficiency. This gene is implicated in Alzheimer's disease (AD) due to its ability to mediate the clearance and degradation of A-beta, the major component of beta-amyloid deposits. A related pseudogene, which is also located on the p arm of chromosome 12, has been identified.
- Versandbedingungen:
- Blue Ice







