RAP1A + RAP1B Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9725
Zusätzliche Namen:: K-REV|RAL1B|RAP1A + RAP1B
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 21kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LYMKNGQGFALVYSITAQSTFNDLQDLREQILRVKDTDDVPMILVGNKCDLEDERVVGKEQGQNLARQWNNCAFLESSAKS
Uniprot:: P61224, P62834
Synonyme:: C21KG;G-22K;GTP-binding protein smg p21A;GTP-binding protein smg p21B;K-REV;KREV-1;KREV1;RAL1B;RAP1;Ras family small GTP binding protein RAP1B;Ras-related protein Krev-1;ras-related protein Rap-1A;ras-related protein Rap-1b;RAS-related protein RAP1B;small GTP binding protein;SMGP21
Weitere Details:: This gene encodes a member of the RAS-like small GTP-binding protein superfamily. Members of this family regulate multiple cellular processes including cell adhesion and growth and differentiation. This protein localizes to cellular membranes and has been shown to regulate integrin-mediated cell signaling. This protein also plays a role in regulating outside-in signaling in platelets. Alternate splicing results in multiple transcript variants. Pseudogenes of this gene are found on chromosomes 3, 5, 6 and 9. [provided by RefSeq, Oct 2011]