A9709
eIF2A Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9709
- Zusätzliche Namen:
- CDA02|EIF-2A|eIF2A|MST089|MSTP004|MSTP089
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 65kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- ALRNKPITNSKLHEEEPPQNMKPQSGNDKPLSKTALKNQRKHEAKKAAKQEARSDKSPDLAPTPAPQSTPRNTVSQSISGDPEIDKKIKNLKKKLKAIEQL
- Uniprot:
- Q9BY44
- Synonyme:
- 65 kDa eukaryotic translation initiation factor 2A;CDA02;EIF-2A;eukaryotic translation initiation factor 2A;eukaryotic translation initiation factor 2A, 65kDa;MST089;MSTP004;MSTP089
- Weitere Details:
- This gene encodes a eukaryotic translation initiation factor that catalyzes the formation of puromycin-sensitive 80 S preinitiation complexes and the poly(U)-directed synthesis of polyphenylalanine at low concentrations of Mg2+. This gene should not be confused with eIF2-alpha (EIF2S1, Gene ID: 1965), the alpha subunit of the eIF2 translation initiation complex. Although both of these proteins function in binding initiator tRNA to the 40 S ribosomal subunit, the encoded protein does so in a codon-dependent manner, whereas eIF2 complex requires GTP. Alternative splicing of this gene results in multiple transcript variants encoding different isoforms.
- Versandbedingungen:
- Blue Ice