Parathyroid Hormone (PTH) Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9704
Zusätzliche Namen:: FIH1|Parathyroid Hormone (PTH)|PTH1
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 13kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MIPAKDMAKVMIVMLAICFLTKSDGKSVKKRSVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGE
Uniprot:: P01270
Synonyme:: FIH1;parathormone;parathyrin;parathyroid hormone;parathyroid hormone 1;prepro-PTH;preproparathyroid hormone;PTH1
Weitere Details:: This gene encodes a member of the parathyroid family of proteins. The encoded preproprotein is proteolytically processed to generate a protein that binds to the parathyroid hormone/parathyroid hormone-related peptide receptor and regulates blood calcium and phosphate levels. Excess production of the encoded protein, known as hyperparathyroidism, can result in hypercalcemia and kidney stones. On the other hand, defective processing of the encoded protein may lead to hypoparathyroidism, which can result in hypocalcemia and numbness. Alternative splicing results in multiple transcript variants.