FER Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9687
Zusätzliche Namen:: FER|p94-Fer|PPP1R74|TYK3
Anwendung:: ELISA, WB
Molekulargewicht:: 110kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YDITLPLLLDSLQKMQEEMIKALKGIFDEYSQITSLVTEEIVNVHKEIQMSVEQIDPSTEYNNFIDVHRTTAAKEQEIEFDTSLLEENENLQANEIMWNNLTAESLQVMLKTLAEELMQTQQMLLNKEEAVLELEKRIEESSETCEKKSDIVLLLSQKQALEELKQSVQQLRCTEAKFSAQKELLEQKVQENDGKEPPPVVNYEEDARSVTSMERKERLSKFESIRHSIAGIIRSPKSALGSSALSDMISI
Uniprot:: P16591
Synonyme:: feline encephalitis virus-related kinase FER;fer (fps/fes related) tyrosine kinase;fujinami poultry sarcoma/Feline sarcoma-related protein Fer;p94-Fer;phosphoprotein NCP94;PPP1R74;protein phosphatase 1, regulatory subunit 74;proto-oncogene c-Fer;TYK3;tyrosine kinase 3;tyrosine-protein kinase Fer
Weitere Details:: The protein encoded by this gene is a member of the FPS/FES family of non-transmembrane receptor tyrosine kinases. It regulates cell-cell adhesion and mediates signaling from the cell surface to the cytoskeleton via growth factor receptors. Alternative splicing results in multiple transcript variants. A related pseudogene has been identified on chromosome X.