A9673
MDH1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9673
- Zusätzliche Namen:
- DEE88|EIEE88|HEL-S-32|KAR|MDH-s|MDH1|MDHA|MGC:1375|MOR2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 36kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- IKARKLSSAMSAAKAICDHVRDIWFGTPEGEFVSMGVISDGNSYGVPDDLLYSFPVVIKNKTWKFVEGLPINDFSREKMDLTAKELTEEKESAFEFLSSA
- Uniprot:
- P40925
- Synonyme:
- cytosolic malate dehydrogenase;DEE88;diiodophenylpyruvate reductase;EIEE88;epididymis secretory protein Li 32;HEL-S-32;KAR;malate dehydrogenase 1, NAD (soluble);malate dehydrogenase, cytoplasmic;malate dehydrogenase, peroxisomal;MDH-s;MDHA;MGC:1375;MOR2;soluble malate dehydrogenase
- Weitere Details:
- This gene encodes an enzyme that catalyzes the NAD/NADH-dependent, reversible oxidation of malate to oxaloacetate in many metabolic pathways, including the citric acid cycle. Two main isozymes are known to exist in eukaryotic cells: one is found in the mitochondrial matrix and the other in the cytoplasm. This gene encodes the cytosolic isozyme, which plays a key role in the malate-aspartate shuttle that allows malate to pass through the mitochondrial membrane to be transformed into oxaloacetate for further cellular processes. Alternatively spliced transcript variants have been found for this gene. A recent study showed that a C-terminally extended isoform is produced by use of an alternative in-frame translation termination codon via a stop codon readthrough mechanism, and that this isoform is localized in the peroxisomes. Pseudogenes have been identified on chromosomes X and 6.
- Versandbedingungen:
- Blue Ice