A9671
MAG Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9671
- Zusätzliche Namen:
- GMA|MAG|S-MAG|SIGLEC-4A|SIGLEC4A|SPG75
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MIFLTALPLFWIMISASRGGHWGAWMPSSISAFEGTCVSIPCRFDFPDELRPAVVHGVWYFNSPYPKNYPPVVFKSRTQVVHESFQGRSRLLGDLGLRNC
- Uniprot:
- P20916
- Synonyme:
- GMA;myelin-associated glycoprotein;S-MAG;sialic acid binding Ig-like lectin 4A;sialic acid-binding immunoglobulin-like lectin 4A;SIGLEC-4A;SIGLEC4A;SPG75
- Weitere Details:
- The protein encoded by this gene is a type I membrane protein and member of the immunoglobulin superfamily. It is thought to be involved in the process of myelination. It is a lectin that binds to sialylated glycoconjugates and mediates certain myelin-neuron cell-cell interactions. Three alternatively spliced transcripts encoding different isoforms have been described for this gene.
- Versandbedingungen:
- Blue Ice