A9670
PIAS1+PIAS2 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9670
- Zusätzliche Namen:
- DDXBP1|GBP|GU/RH-II|PIAS1+PIAS2|ZMIZ3
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 76kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DNQHYNTSLLAAAAAAVSDDQDLLHSSRFFPYTSSQMFLDQLSAGGSTSLPTTNGSSSGSNSSLVSSNSLRESHSHTVTNRSSTDTASIFGIIPDIISLD
- Uniprot:
- O75925, O75928
- Synonyme:
- androgen receptor-interacting protein 3;AR interacting protein;ARIP3;DAB2-interacting protein;DDXBP1;DEAD/H (Asp-Glu-Ala-Asp/His) box binding protein 1;DEAD/H box-binding protein 1;DIP;E3 SUMO-protein ligase PIAS1;E3 SUMO-protein ligase PIAS2;E3 SUMO-protein transferase PIAS1;E3 SUMO-protein transferase PIAS2;GBP;gu-binding protein;GU/RH-II;MIZ1;msx-interacting zinc finger protein;PIAS-NY protein;PIASX;protein inhibitor of activated STAT protein 1;protein inhibitor of activated STAT X;Protein inhibitor of activated STAT2;RNA helicase II-binding protein;SIZ2;zinc finger, MIZ-type containing 3;zinc finger, MIZ-type containing 4;ZMIZ3;ZMIZ4
- Weitere Details:
- This gene encodes a member of the protein inhibitor of activated STAT (PIAS) family. PIAS proteins function as SUMO E3 ligases and play important roles in many cellular processes by mediating the sumoylation of target proteins. This protein plays a central role as a transcriptional coregulator of numerous cellular pathways includign the STAT1 and nuclear factor kappaB pathways. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Mar 2016]
- Versandbedingungen:
- Blue Ice