A9656
SFRP1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9656
- Zusätzliche Namen:
- FRP|FRP-1|FRP1|FrzA|SARP2|SFRP1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 35kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MGIGRSEGGRRGAALGVLLALGAALLAVGSASEYDYVSFQSDIGPYQSGRFYTKPPQCVDIPADLRLCHNVGYKKMVLPNLLEHETMAEVKQQASSWVPL
- Uniprot:
- Q8N474
- Synonyme:
- frizzled-related protein;FRP;FRP-1;FRP1;FrzA;SARP-2;SARP2;secreted apoptosis-related protein 2;secreted frizzled-related protein 1;sFRP-1
- Weitere Details:
- This gene encodes a member of the SFRP family that contains a cysteine-rich domain homologous to the putative Wnt-binding site of Frizzled proteins. Members of this family act as soluble modulators of Wnt signaling; epigenetic silencing of SFRP genes leads to deregulated activation of the Wnt-pathway which is associated with cancer. This gene may also be involved in determining the polarity of photoreceptor cells in the retina.
- Versandbedingungen:
- Blue Ice