ST8SIA1 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9648
Zusätzliche Namen:: GD3S|SIAT8|SIAT8-A|SIAT8A|ST8SIA1|ST8SiaI
Anwendung:: ELISA, WB
Molekulargewicht:: 41kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YRLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRCNLPPLSSEYTKDVGSKSQLVTANPSIIRQRFQNLLWSRKTFVDNMKIYNHSYIYMPAFSMKTGTEPSLRVYYTLSDVGANQTVLFANPNFLRSIGKFWKSRGIHA
Uniprot:: Q92185
Synonyme:: alpha-2,8-sialyltransferase 8A;alpha-N-acetylneuraminide alpha-2,8-sialyltransferase;disialoganglioside (GD3) synthase;ganglioside GD3 synthase;ganglioside GT3 synthase;ganglioside-specific alpha-2,8-polysialyltransferase;GD3S;sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3 synthase) A;Sialyltransferase 8A;sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase, GD3 synthase);sialyltransferase St8Sia I;sialytransferase St8Sia I;SIAT8;SIAT8-A;SIAT8A;ST8 alpha-N-acetylneuraminate alpha-2,8-sialyltransferase 1;ST8SiaI
Weitere Details:: Gangliosides are membrane-bound glycosphingolipids containing sialic acid. Ganglioside GD3 is known to be important for cell adhesion and growth of cultured malignant cells. The protein encoded by this gene is a type II membrane protein that catalyzes the transfer of sialic acid from CMP-sialic acid to GM3 to produce gangliosides GD3 and GT3. The encoded protein may be found in the Golgi apparatus and is a member of glycosyltransferase family 29. Alternatively spliced transcript variants have been found for this gene.

Versandbedingungen:: Blue Ice