SF3B3/SAP130 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9624
Zusätzliche Namen:: RSE1|SAP130|SF3b130|SF3B3/SAP130|STAF130
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 130-136kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: VLSLQKTTLIPGGSESLVYTTLSGGIGILVPFTSHEDHDFFQHVEMHLRSEHPPLCGRDHLSFRSYYFPVKNVIDGDLCEQFNSMEPNKQKNVSEELDRTPPEVSKKLEDIRTRYAF
Uniprot:: Q15393
Synonyme:: pre-mRNA splicing factor SF3b, 130 kDa subunit;Pre-mRNA-splicing factor SF3b 130 kDa subunit;RSE1;SAP 130;SAP130;SF3b130;spliceosome-associated protein 130;splicing factor 3B subunit 3;STAF130
Weitere Details:: This gene encodes subunit 3 of the splicing factor 3b protein complex. Splicing factor 3b, together with splicing factor 3a and a 12S RNA unit, forms the U2 small nuclear ribonucleoproteins complex (U2 snRNP). The splicing factor 3b/3a complex binds pre-mRNA upstream of the intron's branch site in a sequence independent manner and may anchor the U2 snRNP to the pre-mRNA. Splicing factor 3b is also a component of the minor U12-type spliceosome. Subunit 3 has also been identified as a component of the STAGA (SPT3-TAF(II)31-GCN5L acetylase) transcription coactivator-HAT (histone acetyltransferase) complex, and the TFTC (TATA-binding-protein-free TAF(II)-containing complex). These complexes may function in chromatin modification, transcription, splicing, and DNA repair.

Versandbedingungen:: Blue Ice