PSMD14 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9608
Zusätzliche Namen:: PAD1|POH1|PSMD14|RPN11
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: YHSHPGFGCWLSGVDINTQQSFEALSERAVAVVVDPIQSVKGKVVIDAFRLINANMMVLGHEPRQTTSNLGHLNKPSIQALIHGLNRHYYSITINYRKN
Uniprot:: O00487
Synonyme:: 26S proteasome non-ATPase regulatory subunit 14;26S proteasome regulatory subunit rpn11;26S proteasome-associated PAD1 homolog 1;PAD1;POH1;proteasome (prosome, macropain) 26S subunit, non-ATPase, 14;RPN11;testis tissue sperm-binding protein Li 69n
Weitere Details:: This gene encodes a component of the 26S proteasome. The 26S proteasome is a large multiprotein complex that catalyzes the degradation of ubiquitinated intracellular proteins. The encoded protein is a component of the 19S regulatory cap complex of the 26S proteasome and mediates substrate deubiquitination. A pseudogene of this gene is also located on the long arm of chromosome 2.