A9597
alpha 1 Spectrin Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9597
- Zusätzliche Namen:
- alpha 1 Spectrin|EL2|HPP|HS3|SPH3|SPTA
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 280kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- LRGLNYYLPMVEEDEHEPKFEKFLDAVDPGRKGYVSLEDYTAFLIDKESENIKSSDEIENAFQALAEGKSYITKEDMKQALTPEQVSFCATHMQQYMDPRG
- Uniprot:
- P02549
- Synonyme:
- alpha-I spectrin;EL2;elliptocytosis 2;erythroid alpha-spectrin;HPP;HS3;spectrin alpha chain, erythrocyte;spectrin alpha chain, erythrocytic 1;SPH3;SPTA
- Weitere Details:
- This gene encodes a member of a family of molecular scaffold proteins that link the plasma membrane to the actin cytoskeleton and functions in the determination of cell shape, arrangement of transmembrane proteins, and organization of organelles. The encoded protein is primarily composed of 22 spectrin repeats which are involved in dimer formation. It forms a component of the erythrocyte plasma membrane. Mutations in this gene result in a variety of hereditary red blood cell disorders, including elliptocytosis-2, pyropoikilocytosis, and spherocytosis, type 3.
- Versandbedingungen:
- Blue Ice