A9546
Cdx1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9546
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 28kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MYVGYVLDKDSPVYPGPARPASLGLGPQAYGPPAPPPAPPQYPDFSSYSHVEPAPAPPTAWGAPFPAPKDDWAAAYGPGPAAPAASPASLAFGPPPDFSP
- Uniprot:
- P47902
- Synonyme:
- caudal type homeo box transcription factor 1;caudal type homeobox transcription factor 1;caudal-type homeobox protein 1;caudal-type homeobox protein CDX1;homeobox protein CDX-1
- Weitere Details:
- This gene is a member of the caudal-related homeobox transcription factor gene family. The encoded DNA-binding protein regulates intestine-specific gene expression and enterocyte differentiation. It has been shown to induce expression of the intestinal alkaline phosphatase gene, and inhibit beta-catenin/T-cell factor transcriptional activity.
- Versandbedingungen:
- Blue Ice