A9530
ILF2 Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A9530
- Zusätzliche Namen:
- ILF2|NF45|PRO3063
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SALAAIRHARWFEENASQSTVKVLIRLLKDLRIRFPGFEPLTPWILDLLGHYAVMNNPTRQPLALNVAYRRCLQILAAGLFLPGSVGITDPCESGNFRVHT
- Uniprot:
- Q12905
- Synonyme:
- interleukin enhancer binding factor 2, 45kD;interleukin enhancer binding factor 2, 45kDa;interleukin enhancer-binding factor 2;NF45;Nuclear factor of activated T-cells 45 kDa;nuclear factor of activated T-cells, 45-kDa;PRO3063
- Weitere Details:
- The protein encoded by this gene is a transcription factor required for T-cell expression of the interleukin 2 gene. It also binds RNA and is an essential component for encapsidation and protein priming of hepatitis B viral polymerase. The encoded 45 kDa protein (NF45, ILF2) forms a complex with the 90 kDa interleukin enhancer-binding factor 3 (NF90, ILF3), and this complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm, to repair DNA breaks by nonhomologous end joining, and to negatively regulate the microRNA processing pathway. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. Alternative splicing results in multiple transcript variants. Related pseudogenes have been found on chromosomes 3 and 14.
- Versandbedingungen:
- Blue Ice



