CDC5L Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9527
Zusätzliche Namen:: CDC5|CDC5-LIKE|CDC5L|CEF1|dJ319D22.1|PCDC5RP
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 100kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PQISDAELQEVVKVGQASEIARQTAEESGITNSASSTLLSEYNVTNNSVALRTPRTPASQDRILQEAQNLMALTNVDTPLKGGLNTPLHESDFSGVTPQRQ
Uniprot:: Q99459
Synonyme:: CDC5;CDC5 cell division cycle 5-like;CDC5-LIKE;Cdc5-related protein;CEF1;cell division cycle 5-like protein;dJ319D22.1;dJ319D22.1 (CDC5-like protein);PCDC5RP;pombe cdc5-related protein
Weitere Details:: The protein encoded by this gene shares a significant similarity with Schizosaccharomyces pombe cdc5 gene product, which is a cell cycle regulator important for G2/M transition. This protein has been demonstrated to act as a positive regulator of cell cycle G2/M progression. It was also found to be an essential component of a non-snRNA spliceosome, which contains at least five additional protein factors and is required for the second catalytic step of pre-mRNA splicing.