A9519
WSTF Rabbit monoclonal antibody

Größe
Auf Anfrage
- SKU:
- A9519
- Zusätzliche Namen:
- WBSCR10|WBSCR9|WSTF
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 185kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAPLLGRKPFPLVKPLPGEEPLFTIPHTQEAFRTREEYEARLERYSERIWTCKSTGSSQLTHKEAWEEEQEVAELLKEEFPAWYEKLVLEMVHHNTASLE
- Uniprot:
- Q9UIG0
- Synonyme:
- Bromodomain adjacent to zinc finger domain protein 1B;hWALp2;transcription factor WSTF;tyrosine-protein kinase BAZ1B;WBSCR10;WBSCR9;williams syndrome transcription factor;williams-Beuren syndrome chromosomal region 10 protein;williams-Beuren syndrome chromosomal region 9 protein;WSTF
- Weitere Details:
- This gene encodes a member of the bromodomain protein family. The bromodomain is a structural motif characteristic of proteins involved in chromatin-dependent regulation of transcription. This gene is deleted in Williams-Beuren syndrome, a developmental disorder caused by deletion of multiple genes at 7q11.23.
- Versandbedingungen:
- Blue Ice

