IMPDH1 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9497
Zusätzliche Namen:: IMPD|IMPD1|IMPDH-I|IMPDH1|LCA11|RP10|sWSS2608
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MMGSLLAATTEAPGEYFFSDGVRLKKYRGMGSLDAMEKSSSSQKRYFSEGDKVKIAQGVSGSIQDKGSIQKFVPYLIAGIQHGCQDIGARSLSVLRSMMYSGELKFEKRTMSAQIEGGVHGLHSYEKRLY
Uniprot:: P20839
Synonyme:: IMP (inosine 5'-monophosphate) dehydrogenase 1;IMP (inosine monophosphate) dehydrogenase 1;IMPD;IMPD 1;IMPD1;IMPDH 1;IMPDH-I;inosine-5'-monophosphate dehydrogenase 1;LCA11;RP10;sWSS2608
Weitere Details:: The protein encoded by this gene acts as a homotetramer to regulate cell growth. The encoded protein is an enzyme that catalyzes the synthesis of xanthine monophosphate (XMP) from inosine-5'-monophosphate (IMP). This is the rate-limiting step in the de novo synthesis of guanine nucleotides. Defects in this gene are a cause of retinitis pigmentosa type 10 (RP10). Several transcript variants encoding different isoforms have been found for this gene.