PLA2G6 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9492
Zusätzliche Namen:: CaI-PLA2|GVI|INAD1|iPLA2|IPLA2-VIA|iPLA2beta|NBIA2|NBIA2A|NBIA2B|PARK14|PLA2|PLA2G6|PNPLA9
Anwendung:: ELISA, WB
Molekulargewicht:: 82kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EGCTPLHLACRKGDGEILVELVQYCHTQMDVTDYKGETVFHYAVQGDNSQVLQLLGRNAVAGLNQVNNQGLTPLHLACQLGKQEMVRVLLLCNARCNIMG
Uniprot:: O60733
Synonyme:: 2-lysophosphatidylcholine acylhydrolase;85 kDa calcium-independent phospholipase A2;85/88 kDa calcium-independent phospholipase A2;CaI-PLA2;Group VI phospholipase A2;GVI;GVI PLA2;INAD1;intracellular membrane-associated calcium-independent phospholipase A2 beta;iPLA2;iPLA2-beta;IPLA2-VIA;iPLA2beta;NBIA2;NBIA2A;NBIA2B;neurodegeneration with brain iron accumulation 2;palmitoyl-CoA hydrolase;PARK14;patatin-like phospholipase domain-containing protein 9;phospholipase A2, group VI (cytosolic, calcium-independent);PLA2;PNPLA9
Weitere Details:: The protein encoded by this gene is an A2 phospholipase, a class of enzyme that catalyzes the release of fatty acids from phospholipids. The encoded protein may play a role in phospholipid remodelling, arachidonic acid release, leukotriene and prostaglandin synthesis, fas-mediated apoptosis, and transmembrane ion flux in glucose-stimulated B-cells. Several transcript variants encoding multiple isoforms have been described, but the full-length nature of only three of them have been determined to date.

Versandbedingungen:: Blue Ice