SLC34A2 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9460
Zusätzliche Namen:: NAPI-3B|NAPI-IIb|NaPi2b|NPTIIb|PULAM|SLC34A2
Anwendung:: ELISA, WB
Molekulargewicht:: 76 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EVATHYLEIITQLIVESFHFKNGEDAPDLLKVITKPFTKLIVQLDKKVISQIAMNDEKAKNKSLVKIWCKTFTNKTQINVTVPSTANCTSPSLCWTDGIQNWTMKNVTYKENIAKCQHIFVNFHLPDLA
Uniprot:: O95436
Synonyme:: Na(+)-dependent phosphate cotransporter 2B;NAPI-3B;NAPI-IIb;NaPi3b;NPTIIb;PULAM;sodium-dependent phosphate transport protein 2B;sodium/phosphate cotransporter 2B;solute carrier family 34 (sodium phosphate), member 2;solute carrier family 34 (type II sodium/phosphate cotransporter), member 2;Solute carrier family 34 member 2;type II sodium-dependent phosphate transporter 3b
Weitere Details:: The protein encoded by this gene is a pH-sensitive sodium-dependent phosphate transporter. Phosphate uptake is increased at lower pH. Defects in this gene are a cause of pulmonary alveolar microlithiasis. Three transcript variants encoding two different isoforms have been found for this gene.