ITIH3 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9459
Zusätzliche Namen:: H3P|ITI-HC3|ITIH3|SHAP
Anwendung:: ELISA, WB
Molekulargewicht:: 105kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: LPEGVANGIEVYSTKINSKVTSRFAHNVVTMRAVNRADTAKEVSFDVELPKTAFITNFTLTIDGVTYPGNVKEKEVAKKQYEKAVSQGKTAGLVKASGRKLEKFTVSVNVAAGSKVTFELTYEELLKRHKGKYEMYLKVQPKQLVK
Uniprot:: Q06033
Synonyme:: H3P;inter-alpha (globulin) inhibitor H3;inter-alpha (globulin) inhibitor, H3 polypeptide;inter-alpha-inhibitor heavy chain 3;inter-alpha-trypsin inhibitor heavy chain H3;ITI heavy chain H3;ITI-HC3;pre-alpha (globulin) inhibitor, H3 polypeptide;serum-derived hyaluronan-associated protein;SHAP
Weitere Details:: This gene encodes the heavy chain subunit of the pre-alpha-trypsin inhibitor complex. This complex may stabilize the extracellular matrix through its ability to bind hyaluronic acid. Polymorphisms of this gene may be associated with increased risk for schizophrenia and major depressive disorder. This gene is present in an inter-alpha-trypsin inhibitor family gene cluster on chromosome 3.