NUP50 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9441
Zusätzliche Namen:: NPAP60|NPAP60L|NUP50
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 50kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: ENDEPPKVVVTEVKEEDAFYSKKCKLFYKKDNEFKEKGIGTLHLKPTANQKTQLLVRADTNLGNILLNVLIPPNMPCTRTGKNNVLIVCVPNPPIDEKNATMPVTMLIRVKTSEDADELHKILLEKKDA
Uniprot:: Q9UKX7
Synonyme:: 50 kDa nucleoporin;NPAP60;NPAP60L;nuclear pore complex protein Nup50;Nuclear pore-associated protein 60 kDa-like;nuclear pore-associated protein 60L;nucleoporin 50kD;nucleoporin 50kDa;nucleoporin Nup50
Weitere Details:: The nuclear pore complex is a massive structure that extends across the nuclear envelope, forming a gateway that regulates the flow of macromolecules between the nucleus and the cytoplasm. Nucleoporins are the main components of the nuclear pore complex in eukaryotic cells. The protein encoded by this gene is a member of the FG-repeat containing nucleoporins that functions as a soluble cofactor in importin-alpha:beta-mediated nuclear protein import. Pseudogenes of this gene are found on chromosomes 5, 6, and 14. Two transcript variants encoding different isoforms have been found for this gene.