A9426
PCBD1 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9426
- Zusätzliche Namen:
- DCOH|PCBD|PCBD1|PCD|PHS
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 12kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MAGKAHRLSAEERDQLLPNLRAVGWNELEGRDAIFKQFHFKDFNRAFGFMTRVALQAEKLDHHPEWFNVYNKVHITLSTHECAGLSERDINLASFIEQVAVSMT
- Uniprot:
- P61457
- Synonyme:
- 4-alpha-hydroxy-tetrahydropterin dehydratase;6-pyruvoyl-tetrahydropterin synthase/dimerization cofactor of hepatocyte nuclear factor 1 alpha (TCF1);DCOH;Dimerization cofactor of hepatocyte nuclear factor 1-alpha;dimerizing cofactor for HNF1;PCBD;PCD;phenylalanine hydroxylase-stimulating protein;PHS;Pterin carbinolamine dehydratase;pterin-4 alpha-carbinolamine dehydratase/dimerization cofactor of hepatocyte nuclear factor 1 alpha;pterin-4-alpha-carbinolamine dehydratase
- Weitere Details:
- This gene encodes a member of the pterin-4-alpha-carbinolamine dehydratase family. The encoded protein has been identified as a moonlighting protein based on its ability to perform mechanistically distinct functions. The encoded protein functions as both a dehydratase involved in tetrahydrobiopterin biosynthesis, and as a cofactor for HNF1A-dependent transcription. A deficiency of this enzyme leads to hyperphenylalaninemia. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice