A9421
CCDC98 Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9421
- Zusätzliche Namen:
- ABRA1|CCDC98|FAM175A
- Anwendung:
- ELISA, WB, IP
- Molekulargewicht:
- 47kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SCNYNHHLDVVDNLTLMVEHTDIPEASPASTPQIIKHKALDLDDRWQFKRSRLLDTQDKRSKADTGSSNQDKASKMSSPETDEEIEKMKGFGEYSRSPTF
- Uniprot:
- Q6UWZ7
- Synonyme:
- ABRA1;abraxas protein;BRCA1-A complex subunit Abraxas 1;CCDC98;coiled-coil domain containing 98;Coiled-coil domain-containing protein 98;FAM175A;family with sequence similarity 175 member A;Protein FAM175A
- Weitere Details:
- This gene encodes a protein that binds to the C-terminal repeats of breast cancer 1 (BRCA1) through a phospho-SXXF motif. The encoded protein recruits ubiquitin interaction motif containing 1 protein to BRCA1 protein and is required for DNA damage resistance, DNA repair, and cell cycle checkpoint control. Pseudogenes of this gene are found on chromosomes 3 and 8. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice