ENPP5 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9415
Zusätzliche Namen:: ENPP5|NPP-5|NPP5
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 55kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: CHLLNITAMPHNGSFWNVQDLLNSAMPRVVPYTQSTILLPGSVKPAEYDQEGSYPYFIGVSLGSIIVIVFFVIFIKHLIHSQIPALQDMHAEIAQPLLQA
Uniprot:: Q9UJA9
Synonyme:: E-NPP 5;ectonucleotide pyrophosphatase/phosphodiesterase 5 (putative);ectonucleotide pyrophosphatase/phosphodiesterase family member 5;NPP-5;NPP5
Weitere Details:: This gene encodes a type-I transmembrane glycoprotein. Studies in rat suggest the encoded protein may play a role in neuronal cell communications. Alternatively spliced transcript variants have been described.