Kallikrein 8 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9409
Zusätzliche Namen:: HNP|Kallikrein 8|NP|NRPN|PRSS19|TADG14
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: TSPRENFPDTLNCAEVKIFPQKKCEDAYPGQITDGMVCAGSSKGADTCQGDSGGPLVCDGALQGITSWGSDPCGRSDKPGVYTNICRYLDWIKKIIGSKG
Uniprot:: O60259
Synonyme:: HNP;kallikrein-8;Neuropsin;NP;NRPN;ovasin;PRSS19;serine protease 19;serine protease TADG-14;TADG14;tumor-associated differentially expressed gene 14 protein
Weitere Details:: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers. This gene is one of the fifteen kallikrein subfamily members located in tandem in a gene cluster on chromosome 19. The encoded protein may be involved in proteolytic cascade in the skin and may serve as a biomarker for ovarian cancer. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.