THRAP3 Rabbit polyclonal antibody

Größe

£151.00

SKU:: A9396
Zusätzliche Namen:: BCLAF2|THRAP3|TRAP150
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 150kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GGAAYTKRYLEEQKTENGKDKEQKQTNTDKEKIKEKGSFSDTGLGDGKMKSDSFAPKTDSEKPFRGSQSPKRYKLRDDFEKKMADFHKEEMDDQDKDKAKGRKESEFDDEPKFMSKVIGANKNQEEEKSGKWEGLVYAPPGKEKQRKTEELEEESFPERSK
Uniprot:: Q9Y2W1
Synonyme:: BCLAF1 and THRAP3 family member 2;BCLAF2;thyroid hormone receptor-associated protein 3;thyroid hormone receptor-associated protein complex 150 kDa component;thyroid hormone receptor-associated protein, 150 kDa subunit;TR-associated protein, 150-kDa;TRAP150
Weitere Details:: Enables phosphoprotein binding activity; thyroid hormone receptor binding activity; and transcription coactivator activity. Involved in nuclear-transcribed mRNA catabolic process; positive regulation of circadian rhythm; and regulation of RNA metabolic process. Acts upstream of or within positive regulation of transcription by RNA polymerase II. Located in nuclear speck. Part of mediator complex. Colocalizes with exon-exon junction complex.