ERp19 Rabbit monoclonal antibody

Größe

Auf Anfrage

SKU:: A9386
Zusätzliche Namen:: AG1|AGR1|ERP16|ERP18|ERP19|hAG-1|hTLP19|PDIA16|TLP19
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 19kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: METRPRLGATCLLGFSFLLLVISSDGHNGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEP
Uniprot:: O95881
Synonyme:: AG1;AGR1;anterior gradient homolog 1;endoplasmic reticulum protein ERp19;endoplasmic reticulum resident protein 18;endoplasmic reticulum resident protein 19;endoplasmic reticulum thioredoxin superfamily member, 18 kDa;ER protein 18;ER protein 19;ERP16;ERP18;ERP19;hAG-1;hTLP19;PDIA16;protein disulfide isomerase family A, member 16;thioredoxin domain containing 12 (endoplasmic reticulum);thioredoxin domain-containing protein 12;thioredoxin-like protein p19;TLP19
Weitere Details:: This gene encodes a member of the thioredoxin superfamily. Members of this family are characterized by a conserved active motif called the thioredoxin fold that catalyzes disulfide bond formation and isomerization. This protein localizes to the endoplasmic reticulum and has a single atypical active motif. The encoded protein is mainly involved in catalyzing native disulfide bond formation and displays activity similar to protein-disulfide isomerases. This protein may play a role in defense against endoplasmic reticulum stress. Alternate splicing results in both coding and non-coding variants.

Versandbedingungen:: Blue Ice