A9380
Spermine synthase Rabbit monoclonal antibody
Größe
Auf Anfrage
- SKU:
- A9380
- Zusätzliche Namen:
- MRSR|MRXSSR|Spermine synthase|SPMSY|SpS|SRS
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 41 kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TYTNKNGSFANLRIYPHGLVLLDLQSYDGDAQGKEEIDSILNKVEERMKELSQDSTGRVKRLPPIVRGGAIDRYWPTADGRLVEYDIDEVVYDEDSPYQNI
- Uniprot:
- P52788
- Synonyme:
- MRSR;MRXSSR;spermidine aminopropyltransferase;spermine synthase;SPMSY;SpS;SRS
- Weitere Details:
- This gene encodes a protein belonging to the spermidine/spermin synthase family and catalyzes the production of spermine from spermidine. Pseudogenes of this gene are located on chromosomes 1, 5, 6 and X. Mutations in this gene cause an X-linked intellectual disability called Snyder-Robinson Syndrome (SRS). Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice